[Ala11,22,28]VIPPotent, highly selective VPAC1 agonist CAS# 291524-04-4 |
- [Ala2,8,9,11,19,22,24,25,27,28]-VIP
Catalog No.:BCC5973
CAS No.:866552-34-3
- VIP (guinea pig)
Catalog No.:BCC5725
CAS No.:96886-24-7
- PACAP 1-38
Catalog No.:BCC6962
CAS No.:137061-48-4
- Bay 55-9837
Catalog No.:BCC5932
CAS No.:463930-25-8
- PACAP 1-27
Catalog No.:BCC5726
CAS No.:127317-03-7
- VIP (6-28) (human, rat, porcine, bovine)
Catalog No.:BCC5838
CAS No.:69698-54-0
- [D-p-Cl-Phe6,Leu17]-VIP
Catalog No.:BCC5968
CAS No.:102805-45-8
- Oxyntomodulin
Catalog No.:BCC5874
CAS No.:62340-29-8
- Antisauvagine-30
Catalog No.:BCC5868
CAS No.:220673-95-0
- Amyloid Beta-Peptide (1-40) (human)
Catalog No.:BCC1045
CAS No.:131438-79-4
- GIP (1-39)
Catalog No.:BCC5890
CAS No.:725474-97-5
- α-helical CRF 9-41
Catalog No.:BCC5727
CAS No.:90880-23-2
- PHM 27 (human)
Catalog No.:BCC5869
CAS No.:118025-43-7
- CRF (6-33)
Catalog No.:BCC5791
CAS No.:120066-38-8
- Glucagon-like peptide 1 (7-36) amide (human, rat)
Catalog No.:BCC7258
CAS No.:107444-51-9
- GLP-2 (human)
Catalog No.:BCC5891
CAS No.:223460-79-5
- GLP-2 (rat)
Catalog No.:BCC5892
CAS No.:195262-56-7
- PACAP 6-38
Catalog No.:BCC7611
CAS No.:143748-18-9
- [Ac-Tyr1,D-Phe2]GRF 1-29, amide (human)
Catalog No.:BCC5719
CAS No.:93965-89-0
- K 41498
Catalog No.:BCC5867
CAS No.:434938-41-7
- GIP (human)
Catalog No.:BCC5870
CAS No.:100040-31-1
- Secretin (rat)
Catalog No.:BCC5848
CAS No.:121028-49-7
- des-His1-[Glu9]-Glucagon (1-29) amide
Catalog No.:BCC5885
CAS No.:110084-95-2
Quality Control & MSDS
3D structure
Package In Stock
![[Ala11,22,28]VIP](/media/diy/images/package.jpg)
Number of papers citing our products
![Number of papers citing [Ala11,22,28]VIP](/media/diy/images/number_cite.png)
| Cas No. | 291524-04-4 | SDF | File under preparation. |
| PubChem ID | 118856036 | Appearance | Powder |
| Formula | C139H231N43O39S | M.Wt | 3160.68 |
| Type of Compound | N/A | Storage | Desiccate at -20°C |
| Solubility | Soluble in Chloroform,Dichloromethane,Ethyl Acetate,DMSO,Acetone,etc. | ||
| Sequence | HSDAVFTDNYARLRKQMAVKKALNSILA-N | ||
| Chemical Name | 4-[[1-[[1-[[1-[[1-[[1-[[4-amino-1-[[1-[[1-[[1-[[1-[[1-[[6-amino-1-[[5-amino-1-[[1-[[1-[[1-[[6-amino-1-[[6-amino-1-[[1-[[1-[[4-amino-1-[[1-[[1-[[1-[(1-amino-1-oxopropan-2-yl)amino]-4-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-[[2-[[2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-4-oxobutanoic acid | ||
| SMILES | CCC(C)C(C(=O)NC(CC(C)C)C(=O)NC(C)C(=O)N)NC(=O)C(CO)NC(=O)C(CC(=O)N)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CCSC)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(CC1=CC=C(C=C1)O)NC(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C(C(C)O)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(CC3=CNC=N3)N | ||
| Standard InChIKey | VRCDGUGECIERMY-UHFFFAOYSA-N | ||
| Standard InChI | InChI=1S/C139H231N43O39S/c1-20-71(12)108(136(220)174-90(52-66(2)3)123(207)156-72(13)110(147)194)181-133(217)100(64-184)178-129(213)96(59-103(146)189)171-127(211)91(53-67(4)5)168-112(196)74(15)157-116(200)83(34-24-27-46-140)162-119(203)85(36-26-29-48-142)167-134(218)106(69(8)9)179-113(197)75(16)158-117(201)89(45-51-222-19)166-122(206)88(43-44-101(144)187)165-118(202)84(35-25-28-47-141)163-120(204)87(38-31-50-154-139(150)151)164-126(210)92(54-68(6)7)169-121(205)86(37-30-49-153-138(148)149)161-111(195)73(14)159-124(208)93(56-79-39-41-81(186)42-40-79)170-128(212)95(58-102(145)188)172-130(214)98(61-105(192)193)176-137(221)109(77(18)185)182-131(215)94(55-78-32-22-21-23-33-78)175-135(219)107(70(10)11)180-114(198)76(17)160-125(209)97(60-104(190)191)173-132(216)99(63-183)177-115(199)82(143)57-80-62-152-65-155-80/h21-23,32-33,39-42,62,65-77,82-100,106-109,183-186H,20,24-31,34-38,43-61,63-64,140-143H2,1-19H3,(H2,144,187)(H2,145,188)(H2,146,189)(H2,147,194)(H,152,155)(H,156,207)(H,157,200)(H,158,201)(H,159,208)(H,160,209)(H,161,195)(H,162,203)(H,163,204)(H,164,210)(H,165,202)(H,166,206)(H,167,218)(H,168,196)(H,169,205)(H,170,212)(H,171,211)(H,172,214)(H,173,216)(H,174,220)(H,175,219)(H,176,221)(H,177,199)(H,178,213)(H,179,197)(H,180,198)(H,181,217)(H,182,215)(H,190,191)(H,192,193)(H4,148,149,153)(H4,150,151,154) | ||
| General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
| About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
| Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. | ||
| Description | Potent and highly selective agonist for the human VPAC1 receptor (Ki values are 7.4 and 2352 nM for binding to human recombinant VPAC1 and VPAC2 receptors respectively). |
[Ala11,22,28]VIP Dilution Calculator
[Ala11,22,28]VIP Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
- 1-Methoxyberberine
Catalog No.:BCN7373
CAS No.:29133-52-6
- (+)-Affinisine
Catalog No.:BCN3520
CAS No.:2912-11-0
- Guanfacine hydrochloride
Catalog No.:BCC1609
CAS No.:29110-48-3
- Guanfacine
Catalog No.:BCC5180
CAS No.:29110-47-2
- Procyanidin B2
Catalog No.:BCN6315
CAS No.:29106-49-8
- Pinoresinol dimethyl ether
Catalog No.:BCN6767
CAS No.:29106-36-3
- Glipizide
Catalog No.:BCC3785
CAS No.:29094-61-9
- Cimiracemoside D
Catalog No.:BCN2789
CAS No.:290821-39-5
- Avosentan
Catalog No.:BCC1387
CAS No.:290815-26-8
- Eupteleasaponin I
Catalog No.:BCN7839
CAS No.:290809-29-9
- 5-Hydroxy-3',4',7-trimethoxyflavone
Catalog No.:BCN5194
CAS No.:29080-58-8
- Pachymic acid
Catalog No.:BCN6347
CAS No.:29070-92-6
- Shegansu B
Catalog No.:BCN3381
CAS No.:291535-65-4
- 3',6'-Bis(diethylamino)-2-(4-nitrophenyl)spiro[isoindole-1,9'-xanthene]-3-one
Catalog No.:BCC8597
CAS No.:29199-09-5
- Methylprednisolone hemisuccinate
Catalog No.:BCC9044
CAS No.:2921-57-5
- Adenine HCl
Catalog No.:BCC4453
CAS No.:2922-28-3
- H-DL-Phe(4-NO2)-OH
Catalog No.:BCC3279
CAS No.:2922-40-9
- L-Kynurenine
Catalog No.:BCC3899
CAS No.:2922-83-0
- Dehydrotrametenolic acid
Catalog No.:BCN2718
CAS No.:29220-16-4
- SB-3CT
Catalog No.:BCC5486
CAS No.:292605-14-2
- 25,26-Dihydroxyvitamin D3
Catalog No.:BCC4201
CAS No.:29261-12-9
- L-685,458
Catalog No.:BCC2344
CAS No.:292632-98-5
- Deoxyelephantopin
Catalog No.:BCN4655
CAS No.:29307-03-7
- Genipin-1-O-gentiobioside
Catalog No.:BCN5349
CAS No.:29307-60-6
Identification of key residues for interaction of vasoactive intestinal peptide with human VPAC1 and VPAC2 receptors and development of a highly selective VPAC1 receptor agonist. Alanine scanning and molecular modeling of the peptide.[Pubmed:10801840]
J Biol Chem. 2000 Aug 4;275(31):24003-12.
The widespread neuropeptide vasoactive intestinal peptide (VIP) has two receptors VPAC(1) and VPAC(2). Solid-phase syntheses of VIP analogs in which each amino acid has been changed to alanine (Ala scan) or glycine was achieved and each analog was tested for: (i) three-dimensional structure by ab initio molecular modeling; (ii) ability to inhibit (125)I-VIP binding (K(i)) and to stimulate adenylyl cyclase activity (EC(50)) in membranes from cell clones stably expressing human recombinant VPAC(1) or VPAC(2) receptor. The data show that substituting residues at 14 positions out of 28 in VIP resulted in a >10-fold increase of K(i) or EC(50) at the VPAC(1) receptor. Modeling of the three-dimensional structure of native VIP (central alpha-helice from Val(5) to Asn(24) with random coiled N and C terminus) and analogs shows that substitutions of His(1), Val(5), Arg(14), Lys(15), Lys(21), Leu(23), and Ile(26) decreased biological activity without altering the predicted structure, supporting that those residues directly interact with VPAC(1) receptor. The interaction of the analogs with human VPAC(2) receptor is similar to that observed with VPAC(1) receptor, with three remarkable exceptions: substitution of Thr(11) and Asn(28) by alanine increased K(i) for binding to VPAC(2) receptor; substitution of Tyr(22) by alanine increased EC(50) for stimulating adenylyl cyclase activity through interaction with the VPAC(2) receptor. By combining 3 mutations at positions 11, 22, and 28, we developed the [Ala(11,22,28)]VIP analog which constitutes the first highly selective (>1,000-fold) human VPAC(1) receptor agonist derived from VIP ever described.


