Bombinakinin-GAPBioactive, bradykinin-related peptide CAS# 573671-91-7 |
- MK-5172 hydrate
Catalog No.:BCC1763
CAS No.:1350462-55-3
- Telaprevir (VX-950)
Catalog No.:BCC2107
CAS No.:402957-28-2
- Asunaprevir (BMS-650032)
Catalog No.:BCC1374
CAS No.:630420-16-5
- Danoprevir (RG7227)
Catalog No.:BCC2106
CAS No.:850876-88-9
- Narlaprevir
Catalog No.:BCC1785
CAS No.:865466-24-6
- Simeprevir
Catalog No.:BCC1949
CAS No.:923604-59-5
Quality Control & MSDS
3D structure
Package In Stock
Number of papers citing our products

| Cas No. | 573671-91-7 | SDF | Download SDF |
| PubChem ID | 90473869 | Appearance | Powder |
| Formula | C145H219N39O39S3 | M.Wt | 3228.75 |
| Type of Compound | N/A | Storage | Desiccate at -20°C |
| Synonyms | Bombinakinin M Gene Associated Peptide | ||
| Solubility | Soluble to 1 mg/ml in water | ||
| Sequence | DMYEIKQYKTAHGRPPICAPGEQCPIWV (Modifications: Val-28 = C-terminal amide, Disulfide bridge between 18 - 24) | ||
| SMILES | CCC(C)C(C(=O)NC1CSSCC(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C2CCCN2C(=O)C(NC1=O)C)CCC(=O)O)CCC(=O)N)C(=O)N3CCCC3C(=O)NC(C(C)CC)C(=O)NC(CC4=CNC5=CC=CC=C54)C(=O)NC(C(C)C)C(=O)N)NC(=O)C6CCCN6C(=O)C7CCCN7C(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(CC8=CNC=N8)NC(=O)C(C)NC(=O)C(C(C)O)NC(=O)C(CCCCN)NC(=O)C(CC9=CC=C(C=C9)O)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(C(C)CC)NC(=O)C(CCC(=O)O)NC(=O)C(CC1=CC=C(C=C1)O)NC(=O)C(CCSC)NC(=O)C(CC(=O)O)N | ||
| Standard InChIKey | WGYUZJQRZYPVMG-BFMDKFMESA-N | ||
| Standard InChI | InChI=1S/C145H219N39O39S3/c1-13-74(6)115(177-129(208)94(47-51-112(194)195)168-131(210)98(62-81-38-42-85(187)43-39-81)172-127(206)95(52-60-224-12)164-121(200)87(148)65-113(196)197)137(216)169-89(29-18-20-53-146)123(202)166-92(44-48-107(149)188)125(204)171-97(61-80-36-40-84(186)41-37-80)130(209)165-90(30-19-21-54-147)128(207)180-118(79(11)185)140(219)160-77(9)120(199)170-100(64-83-67-154-72-159-83)122(201)157-68-110(191)163-96(31-22-55-155-145(152)153)142(221)184-59-26-35-106(184)144(223)183-58-25-34-105(183)136(215)179-117(76(8)15-3)139(218)174-101-70-225-226-71-102(175-126(205)93(45-49-108(150)189)167-124(203)91(46-50-111(192)193)162-109(190)69-158-134(213)103-32-23-56-181(103)141(220)78(10)161-133(101)212)143(222)182-57-24-33-104(182)135(214)178-116(75(7)14-2)138(217)173-99(132(211)176-114(73(4)5)119(151)198)63-82-66-156-88-28-17-16-27-86(82)88/h16-17,27-28,36-43,66-67,72-79,87,89-106,114-118,156,185-187H,13-15,18-26,29-35,44-65,68-71,146-148H2,1-12H3,(H2,149,188)(H2,150,189)(H2,151,198)(H,154,159)(H,157,201)(H,158,213)(H,160,219)(H,161,212)(H,162,190)(H,163,191)(H,164,200)(H,165,209)(H,166,202)(H,167,203)(H,168,210)(H,169,216)(H,170,199)(H,171,204)(H,172,206)(H,173,217)(H,174,218)(H,175,205)(H,176,211)(H,177,208)(H,178,214)(H,179,215)(H,180,207)(H,192,193)(H,194,195)(H,196,197)(H4,152,153,155)/t74-,75-,76-,77-,78-,79+,87-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,114-,115-,116-,117-,118-/m0/s1 | ||
| General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
| About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
| Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. | ||
| Description | Bioactive bradykinin-related peptide. Induces a 60% reduction in food intake following i.c.v. administration in rats. |
Bombinakinin-GAP Dilution Calculator
Bombinakinin-GAP Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
- Dihydroepistephamiersine 6-acetate
Catalog No.:BCN5775
CAS No.:57361-74-7
- Tacalcitol
Catalog No.:BCC1975
CAS No.:57333-96-7
- Congo Red
Catalog No.:BCC8023
CAS No.:573-58-0
- Liriodendrin
Catalog No.:BCN5774
CAS No.:573-44-4
- Boehmenan
Catalog No.:BCN5773
CAS No.:57296-22-7
- Ridaforolimus (Deforolimus, MK-8669)
Catalog No.:BCC4605
CAS No.:572924-54-0
- Boc-D-Phe(4-F)-OH
Catalog No.:BCC3218
CAS No.:57292-45-2
- Boc-D-Phe(4-Cl)-OH
Catalog No.:BCC3176
CAS No.:57292-44-1
- Calmidazolium chloride
Catalog No.:BCC7410
CAS No.:57265-65-3
- Setiptiline
Catalog No.:BCC1945
CAS No.:57262-94-9
- Salsolinol-1-carboxylic acid
Catalog No.:BCC6731
CAS No.:57256-34-5
- 7-Ethoxyresorufin
Catalog No.:BCC6476
CAS No.:5725-91-7
- Isochlorogenic acid C
Catalog No.:BCN2498
CAS No.:57378-72-0
- Irsogladine
Catalog No.:BCC4562
CAS No.:57381-26-7
- Oroxin A
Catalog No.:BCN1202
CAS No.:57396-78-8
- Benzoin ethyl ether
Catalog No.:BCC8855
CAS No.:574-09-4
- Isoflavone
Catalog No.:BCN8508
CAS No.:574-12-9
- Fraxetin
Catalog No.:BCN5903
CAS No.:574-84-5
- Fexaramine
Catalog No.:BCC7412
CAS No.:574013-66-4
- 8-O-Acetylshanzhiside methyl ester
Catalog No.:BCN5776
CAS No.:57420-46-9
- (2S)-2alpha-(1,3-Benzodioxol-5-yl)-3,5-dihydro-5alpha-methoxy-3beta-methyl-5-allyl-2H-benzofuran-6-one
Catalog No.:BCN6606
CAS No.:57430-03-2
- Methylergometrine maleate
Catalog No.:BCC6691
CAS No.:57432-61-8
- Resiniferatoxin
Catalog No.:BCC6951
CAS No.:57444-62-9
- p-Menth-8-ene-1,2-diol
Catalog No.:BCN5777
CAS No.:57457-97-3
Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima.[Pubmed:12668203]
Peptides. 2003 Feb;24(2):199-204.
A novel 28-amino acid peptide, termed Bombinakinin-GAP, was purified and characterized from skin secretions of the toad Bombina maxima. Its primary structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH(2), in which two cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 32% sequence identity between the sequences of the peptide and a segment of rat cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular (i.c.v.) administration of the peptide induced a significant decrease in food intake in rats, suggesting that it played a role in the control of feeding by brain. Analysis of its cDNA structure revealed that this peptide is coexpressed with bombinakinin M, a bradykinin-related peptide from the same toad. Bombinakinin-GAP appears to be the first example of a novel class of bioactive peptides from amphibian skin, which may be implicated in feeding behavior.


