Exendin-3 (9-39) amidePotent GLP-1 receptor antagonist CAS# 133514-43-9 |
- Exendin-4
Catalog No.:BCC1568
CAS No.:141758-74-9
- Exenatide acetate
Catalog No.:BCN8514
CAS No.:141732-76-5
- Apelin-36 (human)
Catalog No.:BCC5910
CAS No.:252642-12-9
- Apelin-36 (rat, mouse)
Catalog No.:BCC5911
CAS No.:230299-95-3
- GRK2i
Catalog No.:BCC6048
CAS No.:148505-03-7
- Metastin (human)
Catalog No.:BCC5761
CAS No.:374683-24-6
- ACTH (1-39)
Catalog No.:BCC6028
CAS No.:12279-41-3
- Neuropeptide AF (human)
Catalog No.:BCC5854
CAS No.:192387-38-5
Quality Control & MSDS
3D structure
Package In Stock

Number of papers citing our products

| Cas No. | 133514-43-9 | SDF | File under preparation. |
| PubChem ID | 91976991 | Appearance | Powder |
| Formula | C149H234N40O47S | M.Wt | 3369.79 |
| Type of Compound | N/A | Storage | Desiccate at -20°C |
| Solubility | H2O : 50 mg/mL (14.84 mM; Need ultrasonic) | ||
| Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPP (Modifications: Ser-31 = C-terminal amide) | ||
| SMILES | CCC(C)C(C(=O)NC(CCC(=O)O)C(=O)NC(CC1=CNC2=CC=CC=C21)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(=O)N)C(=O)NCC(=O)NCC(=O)N3CCCC3C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N4CCCC4C(=O)N5CCCC5C(=O)N6CCCC6C(=O)NC(CO)C(=O)N)NC(=O)C(CC7=CC=CC=C7)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCSC)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)N | ||
| Standard InChIKey | WSEVKKHALHSUMB-UHFFFAOYSA-N | ||
| Standard InChI | InChI=1S/C149H234N40O47S/c1-14-78(10)120(185-139(227)98(62-81-29-16-15-17-30-81)177-136(224)97(61-76(6)7)175-129(217)88(35-24-53-158-149(156)157)172-144(232)119(77(8)9)184-122(210)79(11)164-126(214)90(41-46-114(199)200)168-131(219)91(42-47-115(201)202)169-132(220)92(43-48-116(203)204)170-134(222)94(50-58-237-13)171-130(218)89(40-45-109(153)194)167-127(215)86(33-20-22-51-150)166-140(228)103(72-192)182-137(225)95(59-74(2)3)174-123(211)84(152)64-118(207)208)145(233)173-93(44-49-117(205)206)133(221)178-99(63-82-66-159-85-32-19-18-31-83(82)85)138(226)176-96(60-75(4)5)135(223)165-87(34-21-23-52-151)128(216)179-100(65-110(154)195)124(212)161-67-111(196)160-69-113(198)186-54-25-36-105(186)142(230)183-104(73-193)141(229)181-102(71-191)125(213)162-68-112(197)163-80(12)146(234)188-56-27-38-107(188)148(236)189-57-28-39-108(189)147(235)187-55-26-37-106(187)143(231)180-101(70-190)121(155)209/h15-19,29-32,66,74-80,84,86-108,119-120,159,190-193H,14,20-28,33-65,67-73,150-152H2,1-13H3,(H2,153,194)(H2,154,195)(H2,155,209)(H,160,196)(H,161,212)(H,162,213)(H,163,197)(H,164,214)(H,165,223)(H,166,228)(H,167,215)(H,168,219)(H,169,220)(H,170,222)(H,171,218)(H,172,232)(H,173,233)(H,174,211)(H,175,217)(H,176,226)(H,177,224)(H,178,221)(H,179,216)(H,180,231)(H,181,229)(H,182,225)(H,183,230)(H,184,210)(H,185,227)(H,199,200)(H,201,202)(H,203,204)(H,205,206)(H,207,208)(H4,156,157,158) | ||
| General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
| About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
| Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. | ||
| Description | Potent and selective GLP-1 receptor antagonist (Kd = 1.7 nM at cloned human GLP-1 receptors). Inhibits cAMP production and insulin release induced by GLP-1 (7-36), exendin-3 (IC50 = 20 nM) and exendin-4. Blocks the inhibitory effect of GLP-1 on food intake in rats. |
Exendin-3 (9-39) amide Dilution Calculator
Exendin-3 (9-39) amide Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
Exendin (9-39) is a specific and competitive glucagon-like peptide-1 receptor antagonist. Sequence: Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2.
In Vitro:GLP-1 plays a role in the control of fasting glucose. Exendin-(9-39), a truncated form of the GLP-1 agonist exendin-4, is a specific GLP-1 receptor antagonist in mice and humans. Exendin (9-39) significantly inhibits amino acid-stimulated insulin secretion in pancreatic islets isolated from neonates with KATPHI[1].
In Vivo:Insulin-to-glucose ratios are significantly lower during Exendin (9-39) infusion compared with vehicle[1]. Continuous subcutaneous infusion of exendin-(9-39) significantly raises fasting blood glucose levels in SUR-1 −/− mice without affecting glucose tolerance or insulin sensitivity[2].
References:
[1]. Calabria AC, et al. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital hyperinsulinism owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012 Oct;61(10):2585-91.
[2]. De León DD, et al. Exendin-(9-39) corrects fasting hypoglycemia in SUR-1-/- mice by lowering cAMP in pancreatic beta-cells and inhibiting insulin secretion. J Biol Chem. 2008 Sep 19;283(38):25786-93.
- SR 1001
Catalog No.:BCC6309
CAS No.:1335106-03-0
- TAI-1
Catalog No.:BCC5576
CAS No.:1334921-03-7
- Fmoc-Glu(OAll)-OH
Catalog No.:BCC3492
CAS No.:133464-46-7
- Iloperidone
Catalog No.:BCC2516
CAS No.:133454-47-4
- Heudelotinone
Catalog No.:BCN6180
CAS No.:133453-58-4
- Angophorol
Catalog No.:BCN3965
CAS No.:133442-54-3
- 3'-Geranyl-3-prenyl-2',4',5,7-tetrahydroxyflavone
Catalog No.:BCN1583
CAS No.:1334309-44-2
- PF 1022A
Catalog No.:BCC8064
CAS No.:133413-70-4
- MG-115
Catalog No.:BCC1237
CAS No.:133407-86-0
- MG-132
Catalog No.:BCC1227
CAS No.:133407-82-6
- (+)-Aflavazole
Catalog No.:BCN7339
CAS No.:133401-09-9
- 3-MPPI
Catalog No.:BCC6705
CAS No.:133399-65-2
- Apigenin 4'-O-rhamnoside
Catalog No.:BCN6181
CAS No.:133538-77-9
- AG-490
Catalog No.:BCC2193
CAS No.:133550-30-8
- Tyrphostin B44, (-) enantiomer
Catalog No.:BCC6703
CAS No.:133550-32-0
- AG 555
Catalog No.:BCC6721
CAS No.:133550-34-2
- AG 494
Catalog No.:BCC6722
CAS No.:133550-35-3
- Tyrphostin B44, (+) enantiomer
Catalog No.:BCC6704
CAS No.:133550-37-5
- AG 556
Catalog No.:BCC6720
CAS No.:133550-41-1
- 4,15-Isoatriplicolide methylacrylate
Catalog No.:BCN7935
CAS No.:133559-38-3
- Isoatriplicolide tiglate
Catalog No.:BCN7934
CAS No.:133559-39-4
- Boc-Glutaminol
Catalog No.:BCC3092
CAS No.:133565-42-1
- Boc-Threoninol(Bzl)
Catalog No.:BCC2704
CAS No.:133565-43-2
- Fmoc-Ile-ol
Catalog No.:BCC2584
CAS No.:133565-46-5
Exendin-3, a novel peptide from Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. Description of exendin-3(9-39) amide, a specific exendin receptor antagonist.[Pubmed:1704369]
J Biol Chem. 1991 Feb 15;266(5):2897-902.
Exendin-3 increased cellular cAMP levels and amylase release from dispersed acini from guinea pig pancreas. Low concentrations (0.1-3 nM) caused a 12-fold increase in cAMP, whereas higher concentrations (0.3-3 microM) caused an additional 24-fold increase in cAMP. Maximal cAMP with the highest concentration tested was the same as the maximal response with secretin, vasoactive intestinal peptide (VIP), peptide histidine isoleucine, helodermin, or helospectin-I. In terms of amylase release, exendin-3 had the same efficacy but was the least potent of these peptides. Exendin-3-induced increases in amylase release were inhibited by VIP receptor antagonists and the new peptide (greater than 0.1 microM) competed with radiolabeled VIP for binding sites on dispersed acini. Increasing concentrations of an exendin-3 fragment, exendin-3(9-39) amide, did not increase cAMP or amylase release but inhibited the increase in cAMP observed with 0.1-3 nM exendin-3. The fragment did not alter the effects of other peptides that are known to increase acinar cAMP. We conclude that exendin-3 interacts with at least two receptors on guinea pig pancreatic acini; at high concentrations (greater than 100 nM) the peptide interacts with VIP receptors, thereby causing a large increase in cAMP and stimulating amylase release; at lower concentrations (0.1-3 nM) the peptide interacts with a putative exendin receptor, thereby causing a smaller increase in cAMP of undetermined function. Exendin-3(9-39) amide is a specific exendin receptor antagonist.
A role for glucagon-like peptide-1 in the central regulation of feeding.[Pubmed:8538742]
Nature. 1996 Jan 4;379(6560):69-72.
The sequence of glucagon-like peptide-1 (7-36) amide (GLP-1) is completely conserved in all mammalian species studied, implying that it plays a critical physiological role. We have shown that GLP-1 and its specific receptors are present in the hypothalamus. No physiological role for central GLP-1 has been established. We report here that intracerebroventricular (ICV) GLP-1 powerfully inhibits feeding in fasted rats. ICV injection of the specific GLP-1-receptor antagonist, exendin (9-39), blocked the inhibitory effect of GLP-1 on food intake. Exendin (9-39) alone had no influence on fast-induced feeding but more than doubled food intake in satiated rats, and augmented the feeding response to the appetite stimulant, neuropeptide Y. Induction of c-fos is a marker of neuronal activation. Following ICV GLP-1 injection, c-fos appeared exclusively in the paraventricular nucleus of the hypothalamus and central nucleus of the amygdala, and this was inhibited by prior administration of exendin (9-39). Both of these regions of the brain are of primary importance in the regulation of feeding. These findings suggest that central GLP-1 is a new physiological mediator of satiety.
Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting beta-cells.[Pubmed:8396143]
J Biol Chem. 1993 Sep 15;268(26):19650-5.
Exendin-4 purified from Heloderma suspectum venom shows structural relationship to the important incretin hormone glucagon-like peptide 1-(7-36)-amide (GLP-1). We demonstrate that exendin-4 and truncated exendin-(9-39)-amide specifically interact with the GLP-1 receptor on insulinoma-derived cells and on lung membranes. Exendin-4 displaced 125I-GLP-1, and unlabeled GLP-1 displaced 125I-exendin-4 from the binding site at rat insulinoma-derived RINm5F cells. Exendin-4 had, like GLP-1, a pronounced effect on intracellular cAMP generation, which was reduced by exendin-(9-39)-amide. When combined, GLP-1 and exendin-4 showed additive action on cAMP. They each competed with the radio-labeled version of the other peptide in cross-linking experiments. The apparent molecular mass of the respective ligand-binding protein complex was 63,000 Da. Exendin-(9-39)-amide abolished the cross-linking of both peptides. Exendin-4, like GLP-1, stimulated dose dependently the glucose-induced insulin secretion in isolated rat islets, and, in mouse insulinoma beta TC-1 cells, both peptides stimulated the proinsulin gene expression at the level of transcription. Exendin-(9-39)-amide reduced these effects. In conclusion, exendin-4 is an agonist and exendin-(9-39)-amide is a specific GLP-1 receptor antagonist.
Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.[Pubmed:8405712]
Diabetes. 1993 Nov;42(11):1678-82.
A complementary DNA for a glucagon-like peptide-1 receptor was isolated from a human pancreatic islet cDNA library. The isolated clone encoded a protein with 90% identity to the rat receptor. In stably transfected fibroblasts, the receptor bound [125I]GLP-1 with high affinity (Kd = 0.5 nM) and was coupled to adenylate cyclase as detected by a GLP-1-dependent increase in cAMP production (EC50 = 93 pM). Two peptides from the venom of the lizard Heloderma suspectum, exendin-4 and exendin-(9-39), displayed similar ligand binding affinities to the human GLP-1 receptor. Whereas exendin-4 acted as an agonist of the receptor, inducing cAMP formation, exendin-(9-39) was an antagonist of the receptor, inhibiting GLP-1-induced cAMP production. Because GLP-1 has been proposed as a potential agent for treatment of NIDDM, our present data will contribute to the characterization of the receptor binding site and the development of new agonists of this receptor.


