GIP (1-39)Highly potent insulinotropic peptide CAS# 725474-97-5 |
- Mycophenolate Mofetil
Catalog No.:BCC2290
CAS No.:128794-94-5
- AGI-5198
Catalog No.:BCC2293
CAS No.:1355326-35-0
- Trilostane
Catalog No.:BCC2302
CAS No.:13647-35-3
- AGI-6780
Catalog No.:BCC1331
CAS No.:1432660-47-3
- CPI-613
Catalog No.:BCC2287
CAS No.:95809-78-2
Quality Control & MSDS
3D structure
Package In Stock

Number of papers citing our products

| Cas No. | 725474-97-5 | SDF | File under preparation. |
| PubChem ID | 131954561 | Appearance | Powder |
| Formula | C210H316N56O61S | M.Wt | 4633.21 |
| Type of Compound | N/A | Storage | Desiccate at -20°C |
| Synonyms | Gastric Inhibitory Polypeptide (1-39) | ||
| Solubility | Soluble to 10 mg/ml in water | ||
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK | ||
| Chemical Name | 5-[[2-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[6-amino-1-[[1-[[1-[[5-amino-1-[[5-amino-1-[[1-[[1-[[1-[[4-amino-1-[[1-[[1-[[1-[[1-[[5-amino-1-[[6-amino-1-[[2-[[6-amino-1-[[6-amino-1-[[1-[[1-[[1-[[6-amino-1-[[1-[(3-amino-1-carboxy-3-oxopropyl)amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-2-oxoethyl]amino]-1-oxohexan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-2-oxoethyl]amino]-4-[2-[[2-amino-3-(4-hydroxyphenyl)propanoyl]amino]propanoylamino]-5-oxopentanoic acid | ||
| SMILES | CCC(C)C(C(=O)NC(CCCNC(=N)N)C(=O)NC(CCC(=O)N)C(=O)NC(CCC(=O)N)C(=O)NC(CC(=O)O)C(=O)NC(CC1=CC=CC=C1)C(=O)NC(C(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CC2=CNC3=CC=CC=C32)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(CCC(=O)N)C(=O)NC(CCCCN)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CO)C(=O)NC(CC(=O)O)C(=O)NC(CC4=CNC5=CC=CC=C54)C(=O)NC(CCCCN)C(=O)NC(CC6=CNC=N6)C(=O)NC(CC(=O)N)C(=O)O)NC(=O)C(CCCCN)NC(=O)C(CC(=O)O)NC(=O)C(CCSC)NC(=O)C(C)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(CC7=CC=C(C=C7)O)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(C(C)CC)NC(=O)C(CC8=CC=CC=C8)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CC9=CC=C(C=C9)O)N | ||
| Standard InChIKey | URQGMGVMCZCZDR-UHFFFAOYSA-N | ||
| Standard InChI | InChI=1S/C210H316N56O61S/c1-18-107(10)169(266-203(320)155(102-269)260-190(307)141(85-117-58-62-122(272)63-59-117)247-197(314)150(93-166(286)287)255-202(319)154(101-268)261-207(324)171(109(12)20-3)265-200(317)143(84-115-44-25-22-26-45-115)256-208(325)172(113(16)270)262-162(279)99-229-178(295)134(67-71-163(280)281)235-173(290)110(13)231-176(293)125(216)82-116-56-60-121(271)61-57-116)205(322)233-112(15)175(292)237-138(72-79-328-17)186(303)253-148(91-164(282)283)195(312)241-132(54-35-40-77-215)187(304)264-170(108(11)19-2)206(323)244-133(55-41-78-225-210(222)223)180(297)242-136(65-69-157(218)274)184(301)243-137(66-70-158(219)275)185(302)252-149(92-165(284)285)196(313)248-142(83-114-42-23-21-24-43-114)199(316)263-168(106(8)9)204(321)257-147(89-159(220)276)194(311)249-145(87-119-96-227-127-49-30-28-47-124(119)127)192(309)246-140(81-105(6)7)189(306)245-139(80-104(4)5)188(305)232-111(14)174(291)236-135(64-68-156(217)273)183(300)238-128(50-31-36-73-211)177(294)228-98-161(278)234-129(51-32-37-74-212)179(296)239-131(53-34-39-76-214)182(299)259-153(100-267)201(318)254-151(94-167(288)289)198(315)250-144(86-118-95-226-126-48-29-27-46-123(118)126)191(308)240-130(52-33-38-75-213)181(298)251-146(88-120-97-224-103-230-120)193(310)258-152(209(326)327)90-160(221)277/h21-30,42-49,56-63,95-97,103-113,125,128-155,168-172,226-227,267-272H,18-20,31-41,50-55,64-94,98-102,211-216H2,1-17H3,(H2,217,273)(H2,218,274)(H2,219,275)(H2,220,276)(H2,221,277)(H,224,230)(H,228,294)(H,229,295)(H,231,293)(H,232,305)(H,233,322)(H,234,278)(H,235,290)(H,236,291)(H,237,292)(H,238,300)(H,239,296)(H,240,308)(H,241,312)(H,242,297)(H,243,301)(H,244,323)(H,245,306)(H,246,309)(H,247,314)(H,248,313)(H,249,311)(H,250,315)(H,251,298)(H,252,302)(H,253,303)(H,254,318)(H,255,319)(H,256,325)(H,257,321)(H,258,310)(H,259,299)(H,260,307)(H,261,324)(H,262,279)(H,263,316)(H,264,304)(H,265,317)(H,266,320)(H,280,281)(H,282,283)(H,284,285)(H,286,287)(H,288,289)(H,326,327)(H4,222,223,225) | ||
| General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
| About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
| Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. | ||
| Description | Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP. |
GIP (1-39) Dilution Calculator
GIP (1-39) Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
- 6-chloro-9h-fluoren-2-amine
Catalog No.:BCC9231
CAS No.:7254-05-9
- Polygonal
Catalog No.:BCN4281
CAS No.:72537-20-3
- XCT790
Catalog No.:BCC5121
CAS No.:725247-18-7
- Paeonolide
Catalog No.:BCN2805
CAS No.:72520-92-4
- Specioside
Catalog No.:BCN4280
CAS No.:72514-90-0
- Lycobetaine
Catalog No.:BCN8313
CAS No.:72510-04-4
- Felodipine
Catalog No.:BCC4402
CAS No.:72509-76-3
- Methyl vanillate glucoside
Catalog No.:BCN4033
CAS No.:72500-11-9
- Pirarubicin
Catalog No.:BCC5092
CAS No.:72496-41-4
- STF 31
Catalog No.:BCC7938
CAS No.:724741-75-7
- Psora 4
Catalog No.:BCC7927
CAS No.:724709-68-6
- Praeruptorin C
Catalog No.:BCN4991
CAS No.:72463-77-5
- Ceftazidime
Catalog No.:BCC5274
CAS No.:72558-82-8
- Rifabutin
Catalog No.:BCC4936
CAS No.:72559-06-9
- Angeloylgomisin Q
Catalog No.:BCN7033
CAS No.:72561-28-5
- Calebassine
Catalog No.:BCN2276
CAS No.:7257-29-6
- Isosilybin
Catalog No.:BCN2406
CAS No.:72581-71-6
- Miglustat
Catalog No.:BCC5187
CAS No.:72599-27-0
- Mocetinostat (MGCD0103, MG0103)
Catalog No.:BCC2146
CAS No.:726169-73-9
- γ1-MSH
Catalog No.:BCC6021
CAS No.:72629-65-3
- Prosapogenin CP6
Catalog No.:BCN2535
CAS No.:72629-76-6
- Mollisorin A
Catalog No.:BCN7236
CAS No.:72704-04-2
- Ilicol
Catalog No.:BCN4282
CAS No.:72715-02-7
- H-D-Lys-OH.HCl
Catalog No.:BCC2989
CAS No.:7274-88-6
Potentiation of glucose-induced insulin secretion in the perfused rat pancreas by porcine GIP (gastric inhibitory polypeptide), bovine GIP, and bovine GIP(1-39).[Pubmed:3529825]
Acta Physiol Scand. 1986 Jul;127(3):323-6.
Porcine GIP (gastric inhibitory polypeptide) potentiates glucose-induced insulin secretion under a variety of experimental conditions. Recently GIP was isolated also from bovine intestine, and found to differ from porcine GIP by having isoleucine instead of lysine in position 37. We have compared the effects of porcine GIP to that of bovine GIP and bovine GIP(1-39) on glucose-induced insulin secretion from the perfused rat pancreas. We found that porcine GIP, bovine GIP, and bovine GIP(1-39) all strongly potentiated both first and second phases of glucose-induced insulin secretion (glucose concentration 6.7 mM; polypeptide concentration 1 nM). There was no significant difference between the polypeptides with regard to the potency to potentiate glucose-induced insulin secretion. We conclude that bovine GIP, as porcine GIP, potentiates glucose-induced insulin secretion, and that the insulinotropic activity of GIP is not confined to the last three amino acids at the C-terminal end.
Comparison of the anti-diabetic effects of GIP- and GLP-1-receptor activation in obese diabetic (ob/ob) mice: studies with DPP IV resistant N-AcGIP and exendin(1-39)amide.[Pubmed:17315241]
Diabetes Metab Res Rev. 2007 Oct;23(7):572-9.
BACKGROUND: The two major incretin hormones, glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) are being actively explored as anti-diabetic agents because they lower blood glucose through multiple mechanisms. The rapid inactivation of GIP and GLP-1 by the ubiquitous enzyme, dipeptidyl peptidase IV (DPP IV) makes their biological actions short-lived, but stable agonists such as N-acetylated GIP (N-AcGIP) and exendin(1-39)amide have been advocated as stable and specific GIP and GLP-1 analogues. METHODS: The present study examined the sub-chronic (14 days) anti-diabetic actions of single daily doses of N-AcGIP and exendin(1-39)amide given alone or in combination to obese diabetic (ob/ob) mice over a 14-day period. RESULTS: Initial experiments confirmed the potent anti-hyperglycaemic and insulinotropic properties of N-AcGIP and exendin(1-39)amide. Sub-chronic administration of N-AcGIP alone or in combination with exendin(1-39)amide significantly decreased non-fasting plasma glucose and improved glucose tolerance compared to control ob/ob mice. This was associated with a significant enhancement of the insulin response to glucose and a notable improvement of insulin sensitivity. Combined treatment with N-AcGIP and exendin(1-39)amide also significantly decreased glycated haemoglobin. Exendin(1-39)amide alone had no significant effect on any of the metabolic parameters monitored. In addition, no significant effects were observed on body weight and food intake in any of the treatment groups. CONCLUSIONS: The results illustrate significant anti-diabetic potential of N-AcGIP alone and in combination with exendin(1-39)amide.


