ω-Agatoxin IVACa2+ channel blocker (P-type) CAS# 145017-83-0 |
- Dihydroberberine
Catalog No.:BCN2573
CAS No.:483-15-8
- Sesamolin
Catalog No.:BCN1289
CAS No.:526-07-8
- Carnosol
Catalog No.:BCN1055
CAS No.:5957-80-2
- Harpagide
Catalog No.:BCN4996
CAS No.:6926-08-5
- Levistilide A
Catalog No.:BCN1197
CAS No.:88182-33-6
Quality Control & MSDS
Number of papers citing our products
![](/media/diy/images/number_cite.png)
Chemical structure
![ω-Agatoxin IVA](/media/images/struct/BCC7488.png)
3D structure
Cas No. | 145017-83-0 | SDF | Download SDF |
PubChem ID | 90488780 | Appearance | Powder |
Formula | C217H360N68O60S10 | M.Wt | 5202.25 |
Type of Compound | N/A | Storage | Desiccate at -20°C |
Synonyms | ω-Aga-IV A | ||
Solubility | Soluble in sterile water | ||
Sequence | KKKCIAKDYGRCKWGGTPCCRGRGCICSIM (Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34) | ||
Chemical Name | 4-[[2-[[2-[[2-[[2-[[1-[6-amino-2-[[87-[[6-amino-2-[[6-amino-2-(2,6-diaminohexanoylamino)hexanoyl]amino]hexanoyl]amino]-60,78-bis(4-aminobutyl)-25-(2-amino-2-oxoethyl)-4,13,84-tri(butan-2-yl)-1a,66,95-tris(3-carbamimidamidopropyl)-31-(2-carboxyethyl)-75-(carboxymethyl)-22,48-bis(1-hydroxyethyl)-10-(hydroxymethyl)-72-[(4-hydroxyphenyl)methyl]-57-(1H-indol-3-ylmethyl)-81-methyl-16-(2-methylsulfanylethyl)-2,2a,5,5a,8,11,12a,14,17,20,23,26,29,32,41,47,50,53,56,59,62,65,68,71,74,77,80,83,86,93,96,99-dotriacontaoxo-8a,9a,14a,15a,36,37,89,90-octathia-a,3,3a,6,6a,9,11a,12,15,18,21,24,27,30,33,40,46,49,52,55,58,61,64,67,70,73,76,79,82,85,94,97-dotriacontazapentacyclo[61.43.4.47,28.239,92.042,46]hexadecahectane-34-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-carbamimidamidopentanoyl]amino]-4-methylpentanoyl]amino]-3-methylpentanoyl]amino]-4-methylsulfanylbutanoyl]amino]-5-[[2-[[1-[[2-[[1-(1-carboxyethylamino)-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-5-oxopentanoic acid | ||
SMILES | CCC(C)C1C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(CSSCC3C(=O)NC4CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(CSSCC(C(=O)N1)NC(=O)CNC(=O)C(NC(=O)CNC(=O)C(NC4=O)CCCNC(=N)N)CCCNC(=N)N)C(=O)NC(C(=O)NC(C(=O)NCC(=O)NCC(=O)NC(C(=O)N5CCCC5C(=O)N3)C(C)O)CC6=CNC7=CC=CC=C76)CCCCN)CCCNC(=N)N)CC8=CC=C(C=C8)O)CC(=O)O)CCCCN)C)C(C)CC)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CCCCN)N)C(=O)NC(CCCCN)C(=O)N9CCCC9C(=O)NC(CCCNC(=N)N)C(=O)NC(CC(C)C)C(=O)NC(C(C)CC)C(=O)NC(CCSC)C(=O)NC(CCC(=O)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C)C(=O)O)CCC(=O)O)NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC2=O)CO)C(C)CC)CCSC)C(C)O)CC(=O)N | ||
Standard InChIKey | NVVFOMZVLALQKT-UHFFFAOYSA-N | ||
Standard InChI | InChI=1S/C217H360N68O60S10/c1-21-111(11)168-206(337)247-115(15)174(305)254-128(48-28-34-70-219)185(316)268-144(89-167(303)304)193(324)266-141(86-119-59-61-121(289)62-60-119)181(312)246-94-159(293)250-127(55-41-77-236-216(230)231)183(314)271-147-101-349-348-100-146-202(333)283-171(114(14)24-4)209(340)277-152-106-354-350-102-148(274-192(323)143(88-156(225)290)269-210(341)172(117(17)287)278-164(298)98-244-179(310)135(67-81-346-19)262-207(338)170(113(13)23-3)281-195(326)145(99-286)270-200(152)331)198(329)260-134(64-66-166(301)302)189(320)272-150(199(330)264-137(52-32-38-74-223)211(342)284-79-43-57-154(284)204(335)261-132(56-42-78-237-217(232)233)187(318)265-140(85-110(9)10)194(325)280-169(112(12)22-2)208(339)263-136(68-82-347-20)190(321)259-133(63-65-165(299)300)178(309)243-95-160(294)251-138(83-108(5)6)180(311)245-96-161(295)252-139(84-109(7)8)191(322)248-116(16)213(344)345)104-352-353-105-151(276-205(336)155-58-44-80-285(155)212(343)173(118(18)288)279-163(297)92-239-157(291)91-240-182(313)142(87-120-90-238-124-47-26-25-45-122(120)124)267-186(317)130(258-197(147)328)50-30-36-72-221)201(332)275-149(196(327)256-126(54-40-76-235-215(228)229)177(308)242-93-158(292)249-125(53-39-75-234-214(226)227)176(307)241-97-162(296)253-146)103-351-355-107-153(203(334)282-168)273-188(319)131(51-31-37-73-222)257-184(315)129(49-29-35-71-220)255-175(306)123(224)46-27-33-69-218/h25-26,45,47,59-62,90,108-118,123,125-155,168-173,238,286-289H,21-24,27-44,46,48-58,63-89,91-107,218-224H2,1-20H3,(H2,225,290)(H,239,291)(H,240,313)(H,241,307)(H,242,308)(H,243,309)(H,244,310)(H,245,311)(H,246,312)(H,247,337)(H,248,322)(H,249,292)(H,250,293)(H,251,294)(H,252,295)(H,253,296)(H,254,305)(H,255,306)(H,256,327)(H,257,315)(H,258,328)(H,259,321)(H,260,329)(H,261,335)(H,262,338)(H,263,339)(H,264,330)(H,265,318)(H,266,324)(H,267,317)(H,268,316)(H,269,341)(H,270,331)(H,271,314)(H,272,320)(H,273,319)(H,274,323)(H,275,332)(H,276,336)(H,277,340)(H,278,298)(H,279,297)(H,280,325)(H,281,326)(H,282,334)(H,283,333)(H,299,300)(H,301,302)(H,303,304)(H,344,345)(H4,226,227,234)(H4,228,229,235)(H4,230,231,236)(H4,232,233,237) | ||
General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. |
Description | Selective blocker of P-type calcium channels (IC50 < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations. |
![](/statics/images/closeICO.png)
ω-Agatoxin IVA Dilution Calculator
![](/statics/images/closeICO.png)
ω-Agatoxin IVA Molarity Calculator
![](/media/diy/images/pphome/Calcutta University.jpg)
Calcutta University
![](/media/diy/images/pphome/University of Minnesota.jpg)
University of Minnesota
![](/media/diy/images/pphome/University of Maryland School of Medicine.jpg)
University of Maryland School of Medicine
![](/media/diy/images/pphome/University of Illinois at Chicago.jpg)
University of Illinois at Chicago
![](/media/diy/images/pphome/The Ohio State University.jpg)
The Ohio State University
![](/media/diy/images/pphome/University of Zurich.jpg)
University of Zurich
![](/media/diy/images/pphome/Harvard University.jpg)
Harvard University
![](/media/diy/images/pphome/Colorado State University.jpg)
Colorado State University
![](/media/diy/images/pphome/Auburn University.jpg)
Auburn University
![](/media/diy/images/pphome/Yale University.jpg)
Yale University
![](/media/diy/images/pphome/Worcester Polytechnic Institute.jpg)
Worcester Polytechnic Institute
![](/media/diy/images/pphome/Washington State University.jpg)
Washington State University
![](/media/diy/images/pphome/Stanford University.jpg)
Stanford University
![](/media/diy/images/pphome/University of Leipzig.jpg)
University of Leipzig
![](/media/diy/images/pphome/Universidade da Beira Interior.jpg)
Universidade da Beira Interior
![](/media/diy/images/pphome/The Institute of Cancer Research.jpg)
The Institute of Cancer Research
![](/media/diy/images/pphome/Heidelberg University.jpg)
Heidelberg University
![](/media/diy/images/pphome/University of Amsterdam.jpg)
University of Amsterdam
![](/media/diy/images/pphome/University of Auckland.jpg)
University of Auckland
![TsingHua University](/media/diy/images/pphome/TsingHua University.jpg)
TsingHua University
![The University of Michigan](/media/diy/images/pphome/University of Michigan.jpg)
The University of Michigan
![Miami University](/media/diy/images/pphome/Miami University.jpg)
Miami University
![DRURY University](/media/diy/images/pphome/DRURY University.jpg)
DRURY University
![Jilin University](/media/diy/images/pphome/Jilin University.jpg)
Jilin University
![Fudan University](/media/diy/images/pphome/Fudan University.jpg)
Fudan University
![Wuhan University](/media/diy/images/pphome/Wuhan University.jpg)
Wuhan University
![Sun Yat-sen University](/media/diy/images/pphome/Sun Yat-sen University.jpg)
Sun Yat-sen University
![Universite de Paris](/media/diy/images/pphome/Universite de Paris.jpg)
Universite de Paris
![Deemed University](/media/diy/images/pphome/Deemed University.jpg)
Deemed University
![Auckland University](/media/diy/images/pphome/Auckland University.jpg)
Auckland University
![The University of Tokyo](/media/diy/images/pphome/Tokyo University.jpg)
The University of Tokyo
![Korea University](/media/diy/images/pphome/Korea University.jpg)
Korea University
- Pregnenolone
Catalog No.:BCN6255
CAS No.:145-13-1
- DGAT1-IN-1
Catalog No.:BCC5511
CAS No.:1449779-49-0
- DDR1-IN-1
Catalog No.:BCC5170
CAS No.:1449685-96-4
- Boeravinone O
Catalog No.:BCN6693
CAS No.:1449384-21-7
- Chlojaponilactone B
Catalog No.:BCN7400
CAS No.:1449382-91-5
- K145 hydrochloride
Catalog No.:BCC4072
CAS No.:1449240-68-9
- Senexin B
Catalog No.:BCC3990
CAS No.:1449228-40-3
- Androst-5-en-3-ol-7,17-dione acetate
Catalog No.:BCC8822
CAS No.:1449-61-2
- 24-Methylenecycloartan-3-ol
Catalog No.:BCN6254
CAS No.:1449-09-8
- 24-Methylenecycloartanone
Catalog No.:BCN7244
CAS No.:1449-08-7
- 21-Episerratenediol
Catalog No.:BCN6253
CAS No.:1449-06-5
- 18alpha-Glycyrrhetinic acid
Catalog No.:BCC8328
CAS No.:1449-05-4
- Digalactosyldiacylglycerol
Catalog No.:BCC8941
CAS No.:145033-48-3
- Fmoc-Asp(OMe)-OH
Catalog No.:BCC3090
CAS No.:145038-53-5
- FGIN-1-43
Catalog No.:BCC6739
CAS No.:145040-29-5
- Candesartan cilexetil
Catalog No.:BCC8900
CAS No.:145040-37-5
- CPI-169
Catalog No.:BCC5396
CAS No.:1450655-76-1
- Rink Amide Linker
Catalog No.:BCC2833
CAS No.:145069-56-3
- YM 022
Catalog No.:BCC7052
CAS No.:145084-28-2
- Filicenol B
Catalog No.:BCN6446
CAS No.:145103-37-3
- Piribedil dihydrochloride
Catalog No.:BCC6898
CAS No.:1451048-94-4
- Dexmedetomidine HCl
Catalog No.:BCC4347
CAS No.:145108-58-3
- 8-Hydroxy-PIPAT oxalate
Catalog No.:BCC6800
CAS No.:1451210-48-2
- 6-Hydroxykaempferol-3,6,7-triglucoside
Catalog No.:BCN1562
CAS No.:145134-62-9
Structure-activity relationships of omega-Agatoxin IVA in lipid membranes.[Pubmed:27838299]
Biochem Biophys Res Commun. 2017 Jan 1;482(1):170-175.
To analyze structural features of omega-Aga IVA, a gating modifier toxin from spider venom, we here investigated the NMR solution structure of omega-Aga IVA within DPC micelles. Under those conditions, the Cys-rich central region of omega-Aga IVA still retains the inhibitor Cys knot motif with three short antiparallel beta-strands seen in water. However, (15)N HSQC spectra of omega-Aga IVA within micelles revealed that there are radical changes to the toxin's C-terminal tail and several loops upon binding to micelles. The C-terminal tail of omega-Aga IVA appears to assume a beta-turn like conformation within micelles, though it is disordered in water. Whole-cell patch clamp studies with several omega-Aga IVA analogs indicate that both the hydrophobic C-terminal tail and an Arg patch in the core region of omega-Aga IVA are critical for Cav2.1 blockade. These results suggest that the membrane environment stabilizes the structure of the toxin, enabling it to act in a manner similar to other gating modifier toxins, though its mode of interaction with the membrane and the channel is unique.
Differential responses to omega-agatoxin IVA in murine frontal cortex and spinal cord derived neuronal networks.[Pubmed:23523780]
Neurotoxicology. 2013 Jul;37:19-25.
omega-Agatoxin-IVA is a well known P/Q-type Ca(2+) channel blocker and has been shown to affect presynaptic Ca(2+) currents as well postsynaptic potentials. P/Q-type voltage gated Ca(2+) channels play a vital role in presynaptic neurotransmitter release and thus play a role in action potential generation. Monitoring spontaneous activity of neuronal networks on microelectrode arrays (MEAs) provides an important tool for examining this neurotoxin. Changes in extracellular action potentials are readily observed and are dependent on synaptic function. Given the efficacy of murine frontal cortex and spinal cord networks to detect neuroactive substances, we investigated the effects of omega-agatoxin on spontaneous action potential firing within these networks. We found that networks derived from spinal cord are more sensitive to the toxin than those from frontal cortex; a concentration of only 10nM produced statistically significant effects on activity from spinal cord networks whereas 50 nM was required to alter activity in frontal cortex networks. Furthermore, the effects of the toxin on frontal cortex are more complex as unit specific responses were observed. These manifested as either a decrease or increase in action potential firing rate which could be statistically separated as unique clusters. Administration of bicuculline, a GABAA inhibitor, isolated a single response to omega-agatoxin, which was characterized by a reduction in network activity. These data support the notion that the two clusters detected with omega-agatoxin exposure represent differential responses from excitatory and inhibitory neuronal populations.
Protease treatment of cerebellar purkinje cells renders omega-agatoxin IVA-sensitive Ca2+ channels insensitive to inhibition by omega-conotoxin GVIA.[Pubmed:17975010]
J Pharmacol Exp Ther. 2008 Feb;324(2):806-14.
The identification of currents carried by N- and P-type Ca(2+) channels in the nervous system relies on the use of omega-conotoxin (CTx) GVIA and omega-agatoxin (Aga) IVA. The peptide omega-Aga-IVA inhibits P-type currents at nanomolar concentrations and N-type currents at micromolar concentrations. omega-CTx-GVIA blocks N-type currents, but there have been no reports that it can also inhibit P-type currents. To assess the effects of omega-CTx-GVIA on P-type channels, we made patch-clamp recordings from the soma of Purkinje cells in cerebellar slices of mature [postnatal days (P) 40-50, P40-50] and immature (P13-20) rats, in which P-type channels carry most of the Ca(2+) channel current (>/=85%). These showed that micromolar concentrations of omega-CTx-GVIA inhibited the current in P40-50 cells (66%, 3 microM; 78%, 10 microM) and in P13-20 Purkinje cells (86%, 3 muM; 89%, 10 microM). The inhibition appeared to be reversible, in contrast to the known irreversible inhibition of N-type current. Exposure of slices from young animals to the enzyme commonly used to dissociate Purkinje cells, protease XXIII, abolished the inhibition by omega-CTx-GVIA but not by omega-Aga-IVA (84%, 30 nM). Our finding that micromolar concentrations of omega-CTx-GVIA inhibit P-type currents suggests that specific block of N-type current requires the use of submicromolar concentrations. The protease-induced removal of block by omega-CTx-GVIA but not by omega-Aga-IVA indicates a selective proteolytic action at site(s) on P-type channels with which omega-CTx-GVIA interacts. It also suggests that Ca(2+) channel pharmacology in neurons dissociated using protease may not predict that in neurons not exposed to the enzyme.
Maturation of rat cerebellar Purkinje cells reveals an atypical Ca2+ channel current that is inhibited by omega-agatoxin IVA and the dihydropyridine (-)-(S)-Bay K8644.[Pubmed:17124267]
J Physiol. 2007 Feb 1;578(Pt 3):693-714.
To determine if the properties of Ca2+ channels in cerebellar Purkinje cells change during postnatal development, we recorded Ca2+ channel currents from Purkinje cells in cerebellar slices of mature (postnatal days (P) 40-50) and immature (P13-20) rats. We found that at P40-50, the somatic Ca2+ channel current was inhibited by omega-agatoxin IVA at concentrations selective for P-type Ca2+ channels (approximately 85%; IC50, <1 nM) and by the dihydropyridine (-)-(S)-Bay K8644 (approximately 70%; IC50, approximately 40 nM). (-)-(S)-Bay K8644 is known to activate L-type Ca2+ channels, but the decrease in current was not secondary to the activation of L-type channels because inhibition by (-)-(S)-Bay K8644 persisted in the presence of the L-type channel blocker (R,S)-nimodipine. By contrast, at P13-20, the current was inhibited by omega-agatoxin IVA (approximately 86%; IC50, approximately 1 nM) and a minor component was inhibited by (R,S)-nimodipine (approximately 8%). The dihydropyridine (-)-(S)-Bay K8644 had no clear effect when applied alone, but in the presence of (R,S)-nimodipine it reduced the current (approximately 40%), suggesting that activation of L-type channels by (-)-(S)-Bay K8644 masks its inhibition of non-L-type channels. Our findings indicate that Purkinje neurons express a previously unrecognized type of Ca2+ channel that is inhibited by omega-agatoxin IVA, like prototypical P-type channels, and by (-)-(S)-Bay K8644, unlike classical P-type or L-type channels. During maturation, there is a decrease in the size of the L-type current and an increase in the size of the atypical Ca2+ channel current. These changes may contribute to the maturation of the electrical properties of Purkinje cells.
Splicing of alpha 1A subunit gene generates phenotypic variants of P- and Q-type calcium channels.[Pubmed:10321243]
Nat Neurosci. 1999 May;2(5):407-15.
P-type and Q-type calcium channels mediate neurotransmitter release at many synapses in the mammalian nervous system. The alpha 1A calcium channel has been implicated in the etiologies of conditions such as episodic ataxia, epilepsy and familial migraine, and shares several properties with native P- and Q-type channels. However, the exact relationship between alpha 1A and P- and Q-type channels is unknown. Here we report that alternative splicing of the alpha 1A subunit gene results in channels with distinct kinetic, pharmacological and modulatory properties. Overall, the results indicate that alternative splicing of the alpha 1A gene generates P-type and Q-type channels as well as multiple phenotypic variants.
P-type calcium channels blocked by the spider toxin omega-Aga-IVA.[Pubmed:1311418]
Nature. 1992 Feb 27;355(6363):827-9.
Voltage-dependent calcium channels mediate calcium entry into neurons, which is crucial for many processes in the brain including synaptic transmission, dendritic spiking, gene expression and cell death. Many types of calcium channels exist in mammalian brains, but high-affinity blockers are available for only two types, L-type channels (targeted by nimodipine and other dihydropyridine channel blockers) and N-type channels (targeted by omega-conotoxin). In a search for new channel blockers, we have identified a peptide toxin from funnel web spider venom, omega-Aga-IVA, which is a potent inhibitor of both calcium entry into rat brain synaptosomes and of 'P-type' calcium channels in rat Purkinje neurons. omega-Aga-IVA will facilitate characterization of brain calcium channels resistant to existing channel blockers and may assist in the design of neuroprotective drugs.
Calcium channels coupled to glutamate release identified by omega-Aga-IVA.[Pubmed:1357749]
Science. 1992 Oct 9;258(5080):310-3.
Presynaptic calcium channels are crucial elements of neuronal excitation-secretion coupling. In mammalian brain, they have been difficult to characterize because most presynaptic terminals are too small to probe with electrodes, and available pharmacological tools such as dihydropyridines and omega-conotoxin are largely ineffective. Subsecond measurements of synaptosomal glutamate release have now been used to assess presynaptic calcium channel activity in order to study the action of peptide toxins from the venom of the funnel web spider Agelenopsis aperta, which is known to inhibit dihydropyridine and omega-conotoxin-resistant neuronal calcium currents. A presynaptic calcium channel important in glutamate release is shown to be omega-Aga-IVA sensitive and omega-conotoxin resistant.