CART (55-102) (human)Neuromodulatory neuropeptide fragment; satiety factor CAS# 214050-22-3 |
2D Structure
- Daptomycin
Catalog No.:BCC1057
CAS No.:103060-53-3
- Nelarabine
Catalog No.:BCC1072
CAS No.:121032-29-9
- Gemcitabine HCl
Catalog No.:BCC1076
CAS No.:122111-03-9
- Clofarabine
Catalog No.:BCC1078
CAS No.:123318-82-1
- Ifosfamide
Catalog No.:BCC1164
CAS No.:3778-73-2
Quality Control & MSDS
3D structure
Package In Stock
Number of papers citing our products
Cas No. | 214050-22-3 | SDF | Download SDF |
PubChem ID | 90488835 | Appearance | Powder |
Formula | C225H365N65O65S7 | M.Wt | 5245.18 |
Type of Compound | N/A | Storage | Desiccate at -20°C |
Solubility | Soluble to 1 mg/ml in water | ||
Sequence | VPIYEKKYGQVPMCDAGEQCAVRKGARIGK (Modifications: Disulfide bridge between 14 - 32, 20 - 40, 34 - 47) | ||
SMILES | CCC(C)C1C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(CSSCC3C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(C(=O)N4CCCC4C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)N3)CO)C(C)O)CCCNC(=N)N)NC(=O)C(NC2=O)CC(=O)O)C(=O)NC(CC(C)C)C(=O)O)CCCCN)CC(C)C)CC(C)C)CC5=CC=CC=C5)CO)CC(=O)N)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)N1)CCCNC(=N)N)C)CCCCN)CCCNC(=N)N)C(C)C)C)CCC(=O)N)CCC(=O)O)C)CC(=O)O)NC(=O)C(CCSC)NC(=O)C6CCCN6C(=O)C(C(C)C)NC(=O)C(CCC(=O)N)NC(=O)CNC(=O)C(CC7=CC=C(C=C7)O)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CCC(=O)O)NC(=O)C(CC8=CC=C(C=C8)O)NC(=O)C(C(C)CC)NC(=O)C9CCCN9C(=O)C(C(C)C)N)CC(C)C)CCCCN | ||
Standard InChIKey | UFCZAYAPDLTVKI-UHFFFAOYSA-N | ||
Standard InChI | InChI=1S/C225H365N65O65S7/c1-24-117(17)177-215(347)248-100-168(302)252-130(48-30-35-76-227)186(318)265-143(89-112(7)8)200(332)280-155-106-359-358-105-154(279-194(326)140(74-86-356-23)263-213(345)160-56-44-85-290(160)221(353)176(116(15)16)285-196(328)136(66-70-162(231)296)253-167(301)99-247-185(317)144(92-124-58-62-126(294)63-59-124)268-189(321)132(50-32-37-78-229)257-187(319)131(49-31-36-77-228)258-192(324)139(69-73-171(306)307)261-201(333)146(93-125-60-64-127(295)65-61-125)273-217(349)178(118(18)25-2)287-214(346)161-57-43-84-289(161)220(352)174(234)114(11)12)209(341)271-148(95-172(308)309)197(329)250-119(19)180(312)244-98-166(300)254-137(68-72-170(304)305)191(323)260-138(67-71-163(232)297)193(325)277-153(207(339)251-121(21)182(314)284-175(115(13)14)216(348)264-134(53-40-81-242-224(237)238)188(320)256-128(47-29-34-75-226)183(315)245-97-165(299)249-120(20)181(313)255-135(195(327)286-177)54-41-82-243-225(239)240)104-357-360-107-156-208(340)270-147(94-164(233)298)203(335)275-151(102-291)205(337)269-145(91-123-45-27-26-28-46-123)202(334)267-142(88-111(5)6)199(331)266-141(87-110(3)4)198(330)259-133(51-33-38-79-230)190(322)278-157(211(343)274-150(222(354)355)90-113(9)10)108-361-362-109-158(282-204(336)149(96-173(310)311)272-210(155)342)219(351)288-83-42-55-159(288)212(344)262-129(52-39-80-241-223(235)236)184(316)246-101-169(303)283-179(122(22)293)218(350)276-152(103-292)206(338)281-156/h26-28,45-46,58-65,110-122,128-161,174-179,291-295H,24-25,29-44,47-57,66-109,226-230,234H2,1-23H3,(H2,231,296)(H2,232,297)(H2,233,298)(H,244,312)(H,245,315)(H,246,316)(H,247,317)(H,248,347)(H,249,299)(H,250,329)(H,251,339)(H,252,302)(H,253,301)(H,254,300)(H,255,313)(H,256,320)(H,257,319)(H,258,324)(H,259,330)(H,260,323)(H,261,333)(H,262,344)(H,263,345)(H,264,348)(H,265,318)(H,266,331)(H,267,334)(H,268,321)(H,269,337)(H,270,340)(H,271,341)(H,272,342)(H,273,349)(H,274,343)(H,275,335)(H,276,350)(H,277,325)(H,278,322)(H,279,326)(H,280,332)(H,281,338)(H,282,336)(H,283,303)(H,284,314)(H,285,328)(H,286,327)(H,287,346)(H,304,305)(H,306,307)(H,308,309)(H,310,311)(H,354,355)(H4,235,236,241)(H4,237,238,242)(H4,239,240,243) | ||
General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. |
Description | Cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced feeding response. |
CART (55-102) (human) Dilution Calculator
CART (55-102) (human) Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
- Taxiphyllin
Catalog No.:BCN4922
CAS No.:21401-21-8
- Chrysin dimethylether
Catalog No.:BCN6799
CAS No.:21392-57-4
- Barbacarpan
Catalog No.:BCN4921
CAS No.:213912-46-0
- 1-Acetoxy-9,17-octadecadiene-12,14-diyne-11,16-diol
Catalog No.:BCN1493
CAS No.:213905-35-2
- Nifenazone
Catalog No.:BCC3822
CAS No.:2139-47-1
- Zedoarofuran
Catalog No.:BCN3527
CAS No.:213833-34-2
- 6,8-Cyclo-1,4-eudesmanediol
Catalog No.:BCN4920
CAS No.:213769-80-3
- 5-Iodo-A-85380, 5-trimethylstannyl N-BOC derivative
Catalog No.:BCC7102
CAS No.:213766-21-3
- Drim-7-ene-11,12-diol acetonide
Catalog No.:BCN4919
CAS No.:213552-47-7
- Flumethasone
Catalog No.:BCC8986
CAS No.:2135-17-3
- Ercalcidiol
Catalog No.:BCC1555
CAS No.:21343-40-8
- 1-Methyl-L-tryptophan
Catalog No.:BCN8341
CAS No.:21339-55-9
- Magnoflorine
Catalog No.:BCN4923
CAS No.:2141-09-5
- Glucoraphanin
Catalog No.:BCN3817
CAS No.:21414-41-5
- 26-Deoxycimicifugoside
Catalog No.:BCN2906
CAS No.:214146-75-5
- 1-Decarboxy-3-oxo-ceanothic acid
Catalog No.:BCN4924
CAS No.:214150-74-0
- Picrotin
Catalog No.:BCC8233
CAS No.:21416-53-5
- N-Benzylphthalimide
Catalog No.:BCC9096
CAS No.:2142-01-0
- 5,7-dimethoxy-2,2-dimethylchromene
Catalog No.:BCN8030
CAS No.:21421-66-9
- Demethylsuberosin
Catalog No.:BCN6508
CAS No.:21422-04-8
- Rosamultic acid
Catalog No.:BCN3516
CAS No.:214285-76-4
- 16alpha-Hydroxybauerenol
Catalog No.:BCN7724
CAS No.:214351-30-1
- 1400W dihydrochloride
Catalog No.:BCC7057
CAS No.:214358-33-5
- (+)-Syringaresinol
Catalog No.:BCN7496
CAS No.:21453-69-0
Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold.[Pubmed:11478874]
Biochemistry. 2001 Aug 7;40(31):9082-8.
Cocaine and amphetamine regulated transcript (CART) peptide has been shown to be an anorectic peptide that inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. The C-terminal part containing the three disulfide bridges CART(48-89) is the biologically active part of the molecule affecting food intake. The solution structure of the active part of CART has a fold equivalent to other functionally distinct small proteins. CART consists mainly of turns and loops spanned by a compact framework composed by a few small stretches of antiparallel beta-sheet common to cystine knots.
CART, a new anorectic peptide.[Pubmed:9924797]
Int J Biochem Cell Biol. 1998 Dec;30(12):1281-4.
Cocaine and amphetamine regulated transcript peptide (CART), is a recently discovered hypothalamic peptide with a potent appetite suppressing activity. In the rat the CART gene encodes a peptide of either 129 or 116 amino acid residues whereas only the short form exists in humans. The predicted signal sequence is 27 amino acid residues resulting in a prohormone of 102 or 89 residues. The C-terminal end of CART, consisting of 48 amino acid residues and 3 disulphide bonds, is thought to constitute a biologically active part of the molecule. In the central nervous system CART is highly expressed in many hypothalamic nuclei, some of which are involved in regulating feeding behaviour. The CART mRNA is regulated by leptin, and the expressed CART is a potent inhibitor of feeding that even overrides the feeding response induced by neuropeptide Y. The putative CART receptor is therefore a potential therapeutic target for an anti-obesity drug.