KaliotoxinKV and KCa blocker CAS# 145199-73-1 |
- 3,3'-Diindolylmethane
Catalog No.:BCC1306
CAS No.:1968-05-4
- BAM7
Catalog No.:BCC1397
CAS No.:331244-89-4
- Bendamustine HCl
Catalog No.:BCC1153
CAS No.:3543-75-7
- Betulinic acid
Catalog No.:BCN5524
CAS No.:472-15-1
- Brassinolide
Catalog No.:BCC1438
CAS No.:72962-43-7
Quality Control & MSDS
3D structure
Package In Stock

Number of papers citing our products

| Cas No. | 145199-73-1 | SDF | File under preparation. |
| PubChem ID | 90488859 | Appearance | Powder |
| Formula | C171H283N55O49S8 | M.Wt | 4149.94 |
| Type of Compound | N/A | Storage | Desiccate at -20°C |
| Solubility | Soluble to 2 mg/ml in water | ||
| Sequence | GVEINVKCSGSPQCLKPCKDAGMRFGKCMN (Modifications: Disulfide bridge between 8 - 28, 14 - 33, 18 - 35) | ||
| SMILES | CCC(C)C(C(=O)NC(CC(=O)N)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC1CSSCC2C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC3CSSCC(C(=O)NC(C(=O)NC(C(=O)N4CCCC4C(=O)NC(CSSCC(NC(=O)C(NC3=O)CC5=CNC=N5)C(=O)NC(C(C)O)C(=O)N6CCCC6C(=O)NC(CCCCN)C(=O)O)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)N2)CCCCN)CC7=CC=CC=C7)CCCNC(=N)N)CCSC)C)CC(=O)O)CCCCN)CCCCN)CC(C)C)NC(=O)C(NC(=O)C8CCCN8C(=O)C(NC(=O)CNC(=O)C(NC1=O)CO)CO)CCC(=O)N)CCCCN)CCCNC(=N)N)CC(=O)N)CCSC)NC(=O)C(CCC(=O)O)NC(=O)C(C(C)C)NC(=O)CN | ||
| Standard InChIKey | VRARWAGTAUYUOO-UHFFFAOYSA-N | ||
| Standard InChI | InChI=1S/C171H283N55O49S8/c1-13-89(8)134(222-148(253)101(48-50-130(237)238)204-163(268)132(87(4)5)220-126(233)72-178)165(270)212-110(70-125(181)232)153(258)221-133(88(6)7)164(269)203-97(39-20-26-56-175)144(249)216-117-82-281-278-79-114-154(259)201-103(52-65-277-12)147(252)210-109(69-124(180)231)152(257)199-98(42-29-59-187-170(182)183)140(245)197-96(38-19-25-55-174)143(248)215-116-81-280-279-80-115(217-145(250)100(47-49-123(179)230)202-160(265)120-44-32-62-225(120)167(272)113(78-228)196-129(236)76-191-138(243)112(77-227)213-158(117)263)156(261)207-106(66-86(2)3)150(255)205-104(40-21-27-57-176)166(271)224-61-31-45-121(224)162(267)219-118(83-282-283-84-119(218-151(256)108(209-157(116)262)68-93-73-186-85-192-93)159(264)223-135(91(10)229)168(273)226-63-33-46-122(226)161(266)206-105(169(274)275)41-22-28-58-177)155(260)200-95(37-18-24-54-173)141(246)211-111(71-131(239)240)149(254)193-90(9)136(241)189-74-127(234)195-102(51-64-276-11)146(251)198-99(43-30-60-188-171(184)185)142(247)208-107(67-92-34-15-14-16-35-92)137(242)190-75-128(235)194-94(139(244)214-114)36-17-23-53-172/h14-16,34-35,73,85-91,94-122,132-135,227-229H,13,17-33,36-72,74-84,172-178H2,1-12H3,(H2,179,230)(H2,180,231)(H2,181,232)(H,186,192)(H,189,241)(H,190,242)(H,191,243)(H,193,254)(H,194,235)(H,195,234)(H,196,236)(H,197,245)(H,198,251)(H,199,257)(H,200,260)(H,201,259)(H,202,265)(H,203,269)(H,204,268)(H,205,255)(H,206,266)(H,207,261)(H,208,247)(H,209,262)(H,210,252)(H,211,246)(H,212,270)(H,213,263)(H,214,244)(H,215,248)(H,216,249)(H,217,250)(H,218,256)(H,219,267)(H,220,233)(H,221,258)(H,222,253)(H,223,264)(H,237,238)(H,239,240)(H,274,275)(H4,182,183,187)(H4,184,185,188) | ||
| General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
| About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
| Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. | ||
| Description | Potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1 and 25 nM for KV1.3, KV1.1 and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. |
Kaliotoxin Dilution Calculator
Kaliotoxin Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
- Iodophenpropit dihydrobromide
Catalog No.:BCC6793
CAS No.:145196-87-8
- 3beta-Hydroxyporiferast-5-en-7-one
Catalog No.:BCN6256
CAS No.:145163-97-9
- CP 99994 dihydrochloride
Catalog No.:BCC6016
CAS No.:145148-39-6
- 6-Hydroxykaempferol 3-Rutinoside -6-glucoside
Catalog No.:BCN1561
CAS No.:145134-63-0
- 6-Hydroxykaempferol-3,6,7-triglucoside
Catalog No.:BCN1562
CAS No.:145134-62-9
- 8-Hydroxy-PIPAT oxalate
Catalog No.:BCC6800
CAS No.:1451210-48-2
- Dexmedetomidine HCl
Catalog No.:BCC4347
CAS No.:145108-58-3
- Piribedil dihydrochloride
Catalog No.:BCC6898
CAS No.:1451048-94-4
- Filicenol B
Catalog No.:BCN6446
CAS No.:145103-37-3
- YM 022
Catalog No.:BCC7052
CAS No.:145084-28-2
- Rink Amide Linker
Catalog No.:BCC2833
CAS No.:145069-56-3
- CPI-169
Catalog No.:BCC5396
CAS No.:1450655-76-1
- Rizatriptan Benzoate
Catalog No.:BCC3852
CAS No.:145202-66-0
- Punctanecine
Catalog No.:BCN2018
CAS No.:145204-91-7
- CALP1
Catalog No.:BCC5873
CAS No.:145224-99-3
- Clobenpropit dihydrobromide
Catalog No.:BCC6781
CAS No.:145231-35-2
- Delgrandine
Catalog No.:BCN8122
CAS No.:145237-05-4
- Sahandol
Catalog No.:BCN6996
CAS No.:1452398-07-0
- Diarylcomosol III
Catalog No.:BCN7201
CAS No.:1452487-93-2
- 20(R)-Protopanaxatriol
Catalog No.:BCN1079
CAS No.:1453-93-6
- A 77636 hydrochloride
Catalog No.:BCC7159
CAS No.:145307-34-2
- TC-E 5002
Catalog No.:BCC5608
CAS No.:1453071-47-0
- Bergenin pentaacetate
Catalog No.:BCN6257
CAS No.:14531-47-6
- Dihydropinosylvin
Catalog No.:BCN6258
CAS No.:14531-52-3
Neuropathophysiological effect and immuno-inflammatory response induced by kaliotoxin of androctonus scorpion venom.[Pubmed:23295619]
Neuroimmunomodulation. 2013;20(2):99-106.
OBJECTIVE: Kaliotoxin (KTX) is a neurotoxin purified from Androctonus scorpion venom. Purification and pharmacological and immunological characterization of this neurotoxin has been extensively studied, but its biological effects have not. The ability of KTX to induce neuropathophysiological and immuno-inflammatory effects was investigated. METHODS: NMRI mice were injected with a sublethal dose of KTX (20 ng/20 g of body weight) or saline solution via the intra-cerebro-ventricular route. Tissue damage and immunological biomarkers such as eosinophil peroxidase (EPO), myeloperoxidase (MPO), and nitric oxide (NO) were analyzed in serum, brain, lung, and heart tissue. Protein levels, LDH, and CPK activities were also determined in serum 24 h after injection. RESULTS: In this study, KTX injection induced severe alterations in the cerebral cortex, myocardium, and pulmonary parenchyma. Tissue damage was correlated with seric increase in creatine kinase and lactate dehydrogenase activities. KTX also induced an immuno-inflammatory response distinguished by cell infiltration characterized by a significant increase in EPO and MPO activities in the brain, heart, and lungs. This infiltration was also associated with an increase in albumin, alpha-, beta-, and gamma-globulin fractions, and NO release. CONCLUSION: KTX binding to its targets in CNS (Kv1.1 and Kv1.3 channels) may induce severe modifications in the structure and function of various organs associated with the activation of immuno-inflammatory reactions.
Total chemical synthesis and X-ray structure of kaliotoxin by racemic protein crystallography.[Pubmed:20877851]
Chem Commun (Camb). 2010 Nov 21;46(43):8174-6.
Here we report the total synthesis of Kaliotoxin by 'one pot' native chemical ligation of three synthetic peptides. A racemic mixture of D- and L-Kaliotoxin synthetic protein molecules gave crystals in the centrosymmetric space group P1 that diffracted to atomic-resolution (0.95 A), enabling the X-ray structure of Kaliotoxin to be determined by direct methods.
Neuro-Modulation of Immuno-Endocrine Response Induced by Kaliotoxin of Androctonus Scorpion Venom.[Pubmed:27271987]
J Biochem Mol Toxicol. 2016 Dec;30(12):580-587.
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. Its use in experimental model could help the understanding of the cellular and molecular mechanisms involved in the neuropathological processes related to potassium channel dysfunctions. In this study, the ability of KTX to stimulate neuro-immuno-endocrine axis was investigated. As results, the intracerebroventricular injection of KTX leads to severe structural-functional alterations of both hypothalamus and thyroid. These alterations were characterized by a massive release of hormones' markers of thyroid function associated with damaged tissue which was infiltrated by inflammatory cell and an imbalanced redox status. Taken together, these data highlight that KTX is able to modulate the neuro-endocrine response after binding to its targets leading to the hypothalamus and the thyroid stimulation, probably by inflammatory response activation and the installation of oxidative stress in these organs.
A new Kaliotoxin selective towards Kv1.3 and Kv1.2 but not Kv1.1 channels expressed in oocytes.[Pubmed:18804453]
Biochem Biophys Res Commun. 2008 Nov 21;376(3):525-30.
In this paper were described the purification, the sequencing, and the immunological and biological characterization of a new Kaliotoxin analog, Aam-KTX, from the venom of the scorpion Androctonus amoreuxi. The toxin effects on three cloned Kv channels (Kv1.1, Kv1.2, and Kv1.3) were investigated in Xenopus oocytes using electrophysiology experiments. The Aam-KTX preference for Kv1.3 channel versus Kv1.2 was expected (EC(50) values, 1.1+/-0.02 and 10.4+/-1.5 nM, respectively) but its total inefficacy on Kv1.1 was very surprising. 3D molecular modeling of Aam-KTX brought putative answers to this difference in selectivity.
High-resolution 3D structure determination of kaliotoxin by solid-state NMR spectroscopy.[Pubmed:18523586]
PLoS One. 2008 Jun 4;3(6):e2359.
High-resolution solid-state NMR spectroscopy can provide structural information of proteins that cannot be studied by X-ray crystallography or solution NMR spectroscopy. Here we demonstrate that it is possible to determine a protein structure by solid-state NMR to a resolution comparable to that by solution NMR. Using an iterative assignment and structure calculation protocol, a large number of distance restraints was extracted from (1)H/(1)H mixing experiments recorded on a single uniformly labeled sample under magic angle spinning conditions. The calculated structure has a coordinate precision of 0.6 A and 1.3 A for the backbone and side chain heavy atoms, respectively, and deviates from the structure observed in solution. The approach is expected to be applicable to larger systems enabling the determination of high-resolution structures of amyloid or membrane proteins.
Distribution in rat brain of binding sites of kaliotoxin, a blocker of Kv1.1 and Kv1.3 alpha-subunits.[Pubmed:10565809]
J Pharmacol Exp Ther. 1999 Dec;291(3):943-52.
The distribution of the binding sites for Kaliotoxin (KTX), a blocker of voltage-dependent K(+) channels, was studied with quantitative autoradiography in adult rat brain and during postnatal brain maturation. Iodinated KTX bound specifically to tissue sections with a high affinity (K(d) = 82 pM) and a maximal binding capacity of 13.4 fmol/mg protein. The distribution of KTX binding sites within the central nervous system was heterogeneous. The highest densities were found in the neocortex, hypothalamus, dentate gyrus, bed nucleus of the stria terminalis, and parabrachial nuclei. The lowest level was observed in the white matter. From postnatal day 5 onward, KTX binding sites were detectable only in the hindbrain. The density of KTX binding sites in whole brain drastically increased after postnatal day 15 to achieve adult levels at postnatal day 60 in the whole brain. Bath application of KTX to Xenopus laevis oocytes blocked recombinant Kv1.3 and Kv1.1 channels potently and Kv1.2 channels less potently, with respective K(d) values of 0.1, 1.5, and 25 nM. KTX affinities for each of these channels expressed in mammalian cells were about 10-fold lower. A comparison of the distribution of KTX binding sites with that of Kv1 channel polypeptides, together with the pharmacology of KTX block, suggests that the principal targets for KTX in rat brain are K(+) channels containing Kv1.1 and Kv1.3 alpha-subunits.
Synthesis and characterization of kaliotoxin. Is the 26-32 sequence essential for potassium channel recognition?[Pubmed:8253752]
J Biol Chem. 1993 Dec 15;268(35):26302-9.
Kaliotoxin (KTX), a scorpion toxin characterized as a 37-residue inhibitor of the neuronal high conductance Ca(2+)-activated K+ channels (KCa channels), has been chemically synthetized. Differences were observed between natural toxin and the two peptides, KTX(1-37) and KTX(1-37)-amide. Re-examination of the KTX sequence showed that an extra lysine residue was present at the C-terminal end. The 38-residue synthetic peptide was found identical with natural toxin. All three peptides had comparable activities, with LD50 values of 6-9 pmol/mouse after intracerebroventricular injection, and Kd = 2-8 nM for blockage of the whole cell and unitary molluscan KCa currents. Pairing of the disulfide bonds in synthetic KTX corresponded to that in charybdotoxin and iberiotoxin. A competition assay between 125I-KTX(1-37) and different toxins (KTX, dendrotoxin, charybdotoxin, MCD peptide, and iberiotoxin) for binding to rat brain synaptosomal membranes suggested that KTX interacts also with voltage-gated K+ channels. Shorter peptides, KTX(25-35)-amide and KTX(26-32)-amide, expressed no KTX activity, but were able to compete in binding. They were further shown to antagonize KTX in both its toxicity and blocking activity. The (26-32) sequence of KTX, which is a highly conserved region, may contain a low affinity binding subsite essential for potassium channel recognition.


