Apelin-36 (rat, mouse)Endogenous APJ receptor agonist CAS# 230299-95-3 |
Related Products
- LDK378
Catalog No.:BCC3691
CAS No.:1032900-25-6
- LDK378 dihydrochloride
Catalog No.:BCC1694
CAS No.:1380575-43-8
- TAE684 (NVP-TAE684)
Catalog No.:BCC3660
CAS No.:761439-42-3
Quality Control & MSDS
3D structure
Package In Stock
Number of papers citing our products
| Cas No. | 230299-95-3 | SDF | Download SDF |
| PubChem ID | 131954568 | Appearance | Powder |
| Formula | C185H304N68O43S | M.Wt | 4200.93 |
| Type of Compound | N/A | Storage | Desiccate at -20°C |
| Solubility | Soluble to 1.60 mg/ml in water | ||
| Sequence | LVKPRTSRTGPGAWQGGRRKFRRQRPRLSH | ||
| Chemical Name | 2-[[1-[2-[[1-[2-[[6-amino-2-[[2-[[2-[[2-[[2-[[1-[2-[[5-amino-2-[[2-[[2-[[2-[[6-amino-2-[[2-[[2-[[2-[[2-[[5-amino-2-[[2-[2-[[2-[[1-[2-[[2-[[2-[[2-[[2-[[2-[[1-[6-amino-2-[[2-[(2-amino-4-methylpentanoyl)amino]-3-methylbutanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-carbamimidamidopentanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-hydroxybutanoyl]amino]acetyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]propanoylamino]-3-(1H-indol-3-yl)propanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]acetyl]amino]-5-carbamimidamidopentanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-3-phenylpropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-oxopentanoyl]amino]-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]-5-carbamimidamidopentanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]hexanoyl]amino]acetyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]pyrrolidine-2-carbonyl]amino]-3-phenylpropanoic acid | ||
| SMILES | CC(C)CC(C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)O)C(=O)NC(CO)C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)O)C(=O)NCC(=O)N2CCCC2C(=O)NCC(=O)NC(C)C(=O)NC(CC3=CNC4=CC=CC=C43)C(=O)NC(CCC(=O)N)C(=O)NCC(=O)NCC(=O)NC(CCCNC(=N)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCCCN)C(=O)NC(CC5=CC=CC=C5)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCC(=O)N)C(=O)NC(CCCNC(=N)N)C(=O)N6CCCC6C(=O)NC(CCCNC(=N)N)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CC7=CNC=N7)C(=O)NC(CCCCN)C(=O)NCC(=O)N8CCCC8C(=O)NC(CCSC)C(=O)N9CCCC9C(=O)NC(CC1=CC=CC=C1)C(=O)O)N | ||
| Standard InChIKey | NRXGOOSANFUBIE-UHFFFAOYSA-N | ||
| Standard InChI | InChI=1S/C185H304N68O43S/c1-98(2)82-109(189)148(266)246-144(100(5)6)172(290)238-122(46-21-24-67-188)174(292)251-78-35-58-135(251)169(287)235-119(53-31-74-215-184(204)205)159(277)248-146(103(9)257)173(291)245-131(96-255)164(282)231-118(52-30-73-214-183(202)203)158(276)247-145(102(8)256)171(289)222-94-143(264)249-76-33-55-132(249)166(284)220-92-140(261)224-101(7)147(265)239-127(86-106-88-217-110-43-18-17-42-108(106)110)162(280)232-120(60-62-137(190)258)150(268)219-90-139(260)218-91-141(262)225-112(47-25-68-209-178(192)193)151(269)228-114(48-26-69-210-179(194)195)152(270)227-113(45-20-23-66-187)155(273)241-126(84-104-38-13-11-14-39-104)161(279)230-116(50-28-71-212-181(198)199)153(271)229-115(49-27-70-211-180(196)197)154(272)233-121(61-63-138(191)259)157(275)236-123(54-32-75-216-185(206)207)175(293)252-79-36-57-134(252)168(286)234-117(51-29-72-213-182(200)201)156(274)240-125(83-99(3)4)160(278)244-130(95-254)165(283)242-128(87-107-89-208-97-223-107)163(281)226-111(44-19-22-65-186)149(267)221-93-142(263)250-77-34-56-133(250)167(285)237-124(64-81-297-10)176(294)253-80-37-59-136(253)170(288)243-129(177(295)296)85-105-40-15-12-16-41-105/h11-18,38-43,88-89,97-103,109,111-136,144-146,217,254-257H,19-37,44-87,90-96,186-189H2,1-10H3,(H2,190,258)(H2,191,259)(H,208,223)(H,218,260)(H,219,268)(H,220,284)(H,221,267)(H,222,289)(H,224,261)(H,225,262)(H,226,281)(H,227,270)(H,228,269)(H,229,271)(H,230,279)(H,231,282)(H,232,280)(H,233,272)(H,234,286)(H,235,287)(H,236,275)(H,237,285)(H,238,290)(H,239,265)(H,240,274)(H,241,273)(H,242,283)(H,243,288)(H,244,278)(H,245,291)(H,246,266)(H,247,276)(H,248,277)(H,295,296)(H4,192,193,209)(H4,194,195,210)(H4,196,197,211)(H4,198,199,212)(H4,200,201,213)(H4,202,203,214)(H4,204,205,215)(H4,206,207,216) | ||
| General tips | For obtaining a higher solubility , please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.Stock solution can be stored below -20℃ for several months. We recommend that you prepare and use the solution on the same day. However, if the test schedule requires, the stock solutions can be prepared in advance, and the stock solution must be sealed and stored below -20℃. In general, the stock solution can be kept for several months. Before use, we recommend that you leave the vial at room temperature for at least an hour before opening it. |
||
| About Packaging | 1. The packaging of the product may be reversed during transportation, cause the high purity compounds to adhere to the neck or cap of the vial.Take the vail out of its packaging and shake gently until the compounds fall to the bottom of the vial. 2. For liquid products, please centrifuge at 500xg to gather the liquid to the bottom of the vial. 3. Try to avoid loss or contamination during the experiment. |
||
| Shipping Condition | Packaging according to customer requirements(5mg, 10mg, 20mg and more). Ship via FedEx, DHL, UPS, EMS or other couriers with RT, or blue ice upon request. | ||
| Description | Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. |
Apelin-36 (rat, mouse) Dilution Calculator
Apelin-36 (rat, mouse) Molarity Calculator
Calcutta University
University of Minnesota
University of Maryland School of Medicine
University of Illinois at Chicago
The Ohio State University
University of Zurich
Harvard University
Colorado State University
Auburn University
Yale University
Worcester Polytechnic Institute
Washington State University
Stanford University
University of Leipzig
Universidade da Beira Interior
The Institute of Cancer Research
Heidelberg University
University of Amsterdam
University of Auckland
TsingHua University
The University of Michigan
Miami University
DRURY University
Jilin University
Fudan University
Wuhan University
Sun Yat-sen University
Universite de Paris
Deemed University
Auckland University
The University of Tokyo
Korea University
Featured Products
- Physalin A
Catalog No.:BCN7920
CAS No.:23027-91-0
- Neoglycyrol
Catalog No.:BCN2907
CAS No.:23013-84-5
- MPTP hydrochloride
Catalog No.:BCC1778
CAS No.:23007-85-4
- Atazanavir sulfate (BMS-232632-05)
Catalog No.:BCC2114
CAS No.:229975-97-7
- AGN 194310
Catalog No.:BCC5416
CAS No.:229961-45-9
- GW9662
Catalog No.:BCC2260
CAS No.:22978-25-2
- Abn-CBD
Catalog No.:BCC7011
CAS No.:22972-55-0
- Desmethoxycentaureidin
Catalog No.:BCN5077
CAS No.:22934-99-2
- Neferine
Catalog No.:BCN6338
CAS No.:2292-16-2
- Ginkgolic acid C15:1
Catalog No.:BCN2307
CAS No.:22910-60-7
- R 892
Catalog No.:BCC5992
CAS No.:229030-05-1
- TAK-779
Catalog No.:BCC4137
CAS No.:229005-80-5
New Products
- Terbutaline Sulfate
Catalog No.:BCC4320
CAS No.:23031-32-5
- Z-β-Ala-OH
Catalog No.:BCC3058
CAS No.:2304-94-1
- Z-Asn-OH
Catalog No.:BCC2794
CAS No.:2304-96-3
- Z-Arg(NO2)-OH
Catalog No.:BCC3063
CAS No.:2304-98-5
- Ajugasterone C
Catalog No.:BCN2757
CAS No.:23044-80-6
- Lofepramine
Catalog No.:BCC7402
CAS No.:23047-25-8
- Dihydroconiferyl alcohol
Catalog No.:BCN7047
CAS No.:2305-13-7
- L-AP4
Catalog No.:BCC6550
CAS No.:23052-81-5
- (-)-Sophoranone
Catalog No.:BCN7162
CAS No.:23057-55-8
- Sinensetin
Catalog No.:BCN6356
CAS No.:2306-27-6
- Varenicline Hydrochloride
Catalog No.:BCC4156
CAS No.:230615-23-3
- Eurycomalactone
Catalog No.:BCN3108
CAS No.:23062-24-0
Molecular properties of apelin: tissue distribution and receptor binding.[Pubmed:11336787]
Biochim Biophys Acta. 2001 Apr 23;1538(2-3):162-71.
We analyzed the tissue distribution of apelin mRNA in rats by a quantitative reverse transcription-polymerase chain reaction and that of immunoreactive apelin (ir-apelin) by an enzyme immunoassay (EIA) using a monoclonal antibody. The expression levels of apelin mRNA and ir-apelin seemed to be consistent among tissues: they were highly expressed in the lung and mammary gland. By the combination of gel filtration and EIA, we found that the molecular forms of apelin differ among respective tissues: apelin molecules with sizes close to apelin-36 (long forms) were major components in the lung, testis, and uterus, but both long and short (whose sizes were close to [ The orphan G protein-coupled receptor APJ has been shown to be a coreceptor for human and simian immunodeficiency virus (HIV and SIV) strains. We have determined that some HIV and SIV strains use APJ as a coreceptor to infect the brain-derived NP-2/CD4 cells. Because apelin is an endogenous ligand for the APJ receptor, we examined the inhibitory effects of apelin peptides on HIV infection, and found that the apelin peptides inhibit the entry of some HIV-1 and HIV-2 into the NP-2/CD4 cells expressing APJ. The inhibitory efficiency has been found to be in the order of apelin-36>apelin-17>apelin-13>apelin-12.Apelin peptides block the entry of human immunodeficiency virus (HIV).[Pubmed:10802050]
FEBS Lett. 2000 May 4;473(1):15-8.
Apelin-36 (rat, mouse),230299-95-3,Natural Products,Apelin Receptor, buy Apelin-36 (rat, mouse) , Apelin-36 (rat, mouse) supplier , purchase Apelin-36 (rat, mouse) , Apelin-36 (rat, mouse) cost , Apelin-36 (rat, mouse) manufacturer , order Apelin-36 (rat, mouse) , high purity Apelin-36 (rat, mouse)
